Antibody data

Product number
H00378925-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00378925-M01, RRID:AB_1580190
Product name
RNF148 monoclonal antibody (M01), clone 2D3
Provider product page
Abnova Corporation - H00378925-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant RNF148.
Antigen sequence
VFPMSHQGTENIVAVMISNLKGMEILHSIQKGVYV
TVIIEVGRMHMQWVSHYIMYLFTFLAATIAYFYLD
CVWRLTPRVPNSFTRRRSQIKTDVKKAIDQ
Isotype
IgG
Antibody clone number
2D3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -