H00004698-M02
antibody from Abnova Corporation
Targeting: NDUFA5
B13, CI-13kB, CI-13KD-B, NUFM, UQOR13
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004698-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004698-M02, RRID:AB_10616925
- Product name
- NDUFA5 monoclonal antibody (M02), clone 4A2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full-length recombinant NDUFA5.
- Antigen sequence
MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVL
EEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED
QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVE
EPPADQWKWPI- Isotype
- IgG
- Antibody clone number
- 4A2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 monoclonal antibody (M02), clone 4A2.Lane 1: NDUFA5 transfected lysate(13.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- NDUFA5 monoclonal antibody (M02), clone 4A2. Western Blot analysis of NDUFA5 expression in human kidney.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged NDUFA5 is 10 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to NDUFA5 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol