Antibody data

Product number
H00010198-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010198-M10, RRID:AB_1137314
Product name
MPHOSPH9 monoclonal antibody (M10), clone 4E10
Provider product page
Abnova Corporation - H00010198-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MPHOSPH9.
Antigen sequence
SVRTAWEKNKSVSYEQCKPVSVTPQGNDFEYTAKI
RTLAETERFFDELTKEKDQIEAALSRMPSPGGRIT
LQTRLNQEALEDRLERINRELGSVRMTLKKFHVLR
TSANL
Isotype
IgG
Antibody clone number
4E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -