HPA028853

ASB15 antibody from MilliporeSigma / Merck KGaA
FLJ43370
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028853
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028853, RRID:AB_10611678
Product name
Anti-ASB15 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028853
Antibody type
Polyclonal
Antigen
ankyrin repeat and SOCS box-containing 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YEIVRLLLSHGANVNCYFMHVNDTRFPSVIQYALN
DEVMLRLLLNNGYQVEMCFDCMHGDIFGNSFVWSE
IQEEVLPGWTSCVIKDNPFCEFITVPWMKHLVGRV
TRVLIDYMDYVPLCAKLKSALEVQRE
Storage
-20C
Provider Type Product Number
- No reagents -