Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057678-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057678-A01, RRID:AB_463501
- Product name
- GPAM polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GPAM.
- Antigen sequence
PEYLQKLHKYLITRTERNVAVYAESATYCLVKNAV
KMFKDIGVFKETKQKRVSVLELSSTFLPQCNRQKL
LEYILSFVVL- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Bezafibrate at clinically relevant doses decreases serum/liver triglycerides via down-regulation of sterol regulatory element-binding protein-1c in mice: a novel peroxisome proliferator-activated receptor alpha-independent mechanism.
Molecular mechanism of age-specific hepatic lipid accumulation in PPARalpha (+/-):LDLR (+/-) mice, an obese mouse model.
Nakajima T, Tanaka N, Kanbe H, Hara A, Kamijo Y, Zhang X, Gonzalez FJ, Aoyama T
Molecular pharmacology 2009 Apr;75(4):782-92
Molecular pharmacology 2009 Apr;75(4):782-92
Molecular mechanism of age-specific hepatic lipid accumulation in PPARalpha (+/-):LDLR (+/-) mice, an obese mouse model.
Li Y, Sugiyama E, Yokoyama S, Jiang L, Tanaka N, Aoyama T
Lipids 2008 Apr;43(4):301-12
Lipids 2008 Apr;43(4):301-12
No comments: Submit comment
No validations: Submit validation data