Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028577 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028577, RRID:AB_10600330
- Product name
- Anti-ADAMTS9
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQRE
PSTGRHACDTSEHKNRHSKDKKKTRARKWGERINL
AGD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Systematic analysis of protease gene expression in the rhesus macaque ovulatory follicle: metalloproteinase involvement in follicle rupture.
Peluffo MC, Murphy MJ, Baughman ST, Stouffer RL, Hennebold JD
Endocrinology 2011 Oct;152(10):3963-74
Endocrinology 2011 Oct;152(10):3963-74
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows strong cytoplasmic positivity in paneth cells.
- Sample type
- HUMAN