Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003659-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003659-M01, RRID:AB_490096
- Product name
- IRF1 monoclonal antibody (M01), clone 2E4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant IRF1.
- Antigen sequence
PMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTN
VDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGG
DIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQA
IPCAP- Isotype
- IgG
- Antibody clone number
- 2E4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Defining critical roles for NF-κB p65 and type I interferon in innate immunity to rhinovirus.
Bartlett NW, Slater L, Glanville N, Haas JJ, Caramori G, Casolari P, Clarke DL, Message SD, Aniscenko J, Kebadze T, Zhu J, Mallia P, Mizgerd JP, Belvisi M, Papi A, Kotenko SV, Johnston SL, Edwards MR
EMBO molecular medicine 2012 Dec;4(12):1244-60
EMBO molecular medicine 2012 Dec;4(12):1244-60
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- IRF1 monoclonal antibody (M01), clone 2E4 Western Blot analysis of IRF1 expression in COLO 320 HSR ( Cat # L020V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged IRF1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol