Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309855 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Interferon Regulatory Factor 1 (IRF1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-IRF1 antibody: synthetic peptide directed towards the N terminal of human IRF1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine
- Host
- Rabbit
- Antigen sequence
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQ
IPWKH AAKHGWDINK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Human serum from patients with septic shock activates transcription factors STAT1, IRF1, and NF-kappaB and induces apoptosis in human cardiac myocytes.
Kumar A, Kumar A, Michael P, Brabant D, Parissenti AM, Ramana CV, Xu X, Parrillo JE
The Journal of biological chemistry 2005 Dec 30;280(52):42619-26
The Journal of biological chemistry 2005 Dec 30;280(52):42619-26
No comments: Submit comment
No validations: Submit validation data