Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026291-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026291-M01, RRID:AB_425933
- Product name
- FGF21 monoclonal antibody (M01), clone 2F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant FGF21.
- Antigen sequence
PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIR
EDGTVGGAADQSPESLLQLKALKPGVIQILGVKTS
RFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNV
YQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPG
LPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRS
PSYAS- Isotype
- IgG
- Antibody clone number
- 2F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of FGF21 expression in transfected 293T cell line by FGF21 monoclonal antibody (M01), clone 2F11.Lane 1: FGF21 transfected lysate(22.3 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FGF21 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to FGF21 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol