HPA032054

SF3A3 antibody from MilliporeSigma / Merck KGaA
PRP9, PRPF9, SAP61, SF3a60
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA032054
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA032054, RRID:AB_10602184
Product name
Anti-SF3A3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA032054
Antibody type
Polyclonal
Antigen
splicing factor 3a, subunit 3, 60kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYD
DKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRK
HPNEICVPMSVEFE
Storage
-20C
Provider Type Product Number
- No reagents -