Antibody data
- Antibody Data
- Antigen structure
- References [9]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000381-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000381-M01, RRID:AB_489724
- Product name
- ARF5 monoclonal antibody (M01), clone 1B4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARF5.
- Antigen sequence
YFQNTQGLIFVVDSNDRERVQESADELQKMLQEDE
LRDAVLLVFANKQDMPNAMPVSELTDKLGLQHLRS
RTWYVQATCATQGTGLYDGLDWLSHELSKR- Isotype
- IgG
- Antibody clone number
- 1B4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.
IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells.
A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses.
GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity.
EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and -independent pathway.
The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles.
Hanai A, Ohgi M, Yagi C, Ueda T, Shin HW, Nakayama K
Journal of biochemistry 2016 Feb;159(2):201-8
Journal of biochemistry 2016 Feb;159(2):201-8
IGF-1 drives chromogranin A secretion via activation of Arf1 in human neuroendocrine tumour cells.
Münzberg C, Höhn K, Krndija D, Maaß U, Bartsch DK, Slater EP, Oswald F, Walther P, Seufferlein T, von Wichert G
Journal of cellular and molecular medicine 2015 May;19(5):948-59
Journal of cellular and molecular medicine 2015 May;19(5):948-59
A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
Reiling JH, Olive AJ, Sanyal S, Carette JE, Brummelkamp TR, Ploegh HL, Starnbach MN, Sabatini DM
Nature cell biology 2013 Dec;15(12):1473-85
Nature cell biology 2013 Dec;15(12):1473-85
ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
Nakai W, Kondo Y, Saitoh A, Naito T, Nakayama K, Shin HW
Molecular biology of the cell 2013 Aug;24(16):2570-81
Molecular biology of the cell 2013 Aug;24(16):2570-81
Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses.
Kudelko M, Brault JB, Kwok K, Li MY, Pardigon N, Peiris JS, Bruzzone R, Desprès P, Nal B, Wang PG
The Journal of biological chemistry 2012 Jan 2;287(1):767-77
The Journal of biological chemistry 2012 Jan 2;287(1):767-77
GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
Takashima K, Saitoh A, Hirose S, Nakai W, Kondo Y, Takasu Y, Kakeya H, Shin HW, Nakayama K
Cell structure and function 2011;36(2):223-35
Cell structure and function 2011;36(2):223-35
Interaction of phosphodiesterase 3A with brefeldin A-inhibited guanine nucleotide-exchange proteins BIG1 and BIG2 and effect on ARF1 activity.
Puxeddu E, Uhart M, Li CC, Ahmad F, Pacheco-Rodriguez G, Manganiello VC, Moss J, Vaughan M
Proceedings of the National Academy of Sciences of the United States of America 2009 Apr 14;106(15):6158-63
Proceedings of the National Academy of Sciences of the United States of America 2009 Apr 14;106(15):6158-63
EFA6 facilitates the assembly of the tight junction by coordinating an Arf6-dependent and -independent pathway.
Klein S, Partisani M, Franco M, Luton F
The Journal of biological chemistry 2008 Oct 31;283(44):30129-38
The Journal of biological chemistry 2008 Oct 31;283(44):30129-38
The brefeldin A-inhibited guanine nucleotide-exchange protein, BIG2, regulates the constitutive release of TNFR1 exosome-like vesicles.
Islam A, Shen X, Hiroi T, Moss J, Vaughan M, Levine SJ
The Journal of biological chemistry 2007 Mar 30;282(13):9591-9
The Journal of biological chemistry 2007 Mar 30;282(13):9591-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARF5 monoclonal antibody (M01), clone 1B4 Western Blot analysis of ARF5 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ARF5 expression in transfected 293T cell line by ARF5 monoclonal antibody (M01), clone 1B4.Lane 1: ARF5 transfected lysate(20.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ARF5 monoclonal antibody (M01), clone 1B4. Western Blot analysis of ARF5 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARF5 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to ARF5 on HeLa cell. [antibody concentration 15 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol