H00023499-M08
antibody from Abnova Corporation
Targeting: MACF1
ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00023499-M08 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00023499-M08, RRID:AB_10718674
- Product name
- MACF1 monoclonal antibody (M08), clone 1G9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MACF1.
- Antigen sequence
KIEDEVTRQVAQCKCAKRFQVEQIGENKYRFGDSQ
QLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRA
RGRTNIELREKFILPEGASQGMTPF- Isotype
- IgG
- Antibody clone number
- 1G9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MACF1 expression in transfected 293T cell line by MACF1 monoclonal antibody (M08), clone 1G9.Lane 1: MACF1 transfected lysate(10.45 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MACF1 is 0.03 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol