HPA013713

MACF1 antibody from Sigma-Aldrich
ABP620, ACF7, FLJ45612, FLJ46776, KIAA0465, KIAA1251, MACF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013713
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013713, RRID:AB_10600821
Product name
Anti-MACF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013713
Antibody type
Polyclonal
Antigen
microtubule-actin crosslinking factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESANVKISGTFSSGWTVRLPEFQFSSQNKEYPDRE
DCTTEKGKKTTVETEDSSVENPEQDLFVEQKERNP
NIDALKVINKVKLEVQRQLIGTQREDQTAVSVREN
ASRGHLLTIPPAEAEGVPLVVDKDVFSVETPKKE
Storage
-20C
Provider Type Product Number
- No reagents -