Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006836-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006836-M01, RRID:AB_566219
- Product name
- SURF4 monoclonal antibody (M01), clone 3D12
- Antibody type
- Monoclonal
- Antigen
- SURF4 (NP_149351, 1 a.a. ~ 60 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLIS
TFLEDGIRMWFQWSEQRDYIDTTWN- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of SURF4 expression in transfected 293T cell line by SURF4 monoclonal antibody (M01), clone 3D12.Lane 1: SURF4 transfected lysate(30.394 KDa).Lane 2: Non-transfected lysate.
- Validation comment
- Western Blot (Transfected lysate)
- Protocol
- Protocol