HPA030327

PM20D2 antibody from MilliporeSigma / Merck KGaA
ACY1L2, bA63L7.3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030327
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030327, RRID:AB_10603129
Product name
Anti-PM20D2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030327
Antibody type
Polyclonal
Antigen
peptidase M20 domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFY
TLRTAKALAMTALDVIFKPELLEGIREDFKLKLQE
EQFVN
Storage
-20C
Provider Type Product Number
- No reagents -