H00114769-B01

CARD16 antibody from Abnova Corporation
COP, COP1, PSEUDO-ICE

Antibody data

Product number
H00114769-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00114769-B01, RRID:AB_982473
Product name
COP1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00114769-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human COP1 protein.
Antigen sequence
MADKVLKEKRKLFIHSMGEGTINGLLDELLQTRVL
NQEEMEKVKRENATVMDKTRALIDSVIPKGAQACQ
ICITYICEEDSYLAETLGLSAGPIPGN
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -