HPA026092

HNRNPR antibody from Sigma-Aldrich
hnRNP-R, HNRPR
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026092
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026092, RRID:AB_1850885
Product name
Anti-HNRNPR antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026092
Antibody type
Polyclonal
Antigen
Heterogeneous nuclear ribonucleoprotein R recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIE
AGLPQKVAERLDEIFQT
Storage
-20C
Provider Type Product Number
- No reagents -