Antibody data

Product number
H00055798-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055798-M03, RRID:AB_1237781
Product name
METTL2 monoclonal antibody (M03), clone 2A9
Provider product page
Abnova Corporation - H00055798-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant METTL2.
Antigen sequence
SQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQ
HKCSSKSLEHKTQTPPVEENVTQKISDLEICAD
Isotype
IgG
Antibody clone number
2A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -