H00079949-B01P

PLEKHS1 antibody from Abnova Corporation
bA211N11.2, C10orf81, FLJ23537

Antibody data

Product number
H00079949-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00079949-B01P, RRID:AB_1137818
Product name
C10orf81 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00079949-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human C10orf81 protein.
Antigen sequence
MEQSSPGFRQTHLQDLSEATQDVKEENHYLTPRSV
LLELDNIIASSDSGESIETDGPDQVSGRIECHYEP
MESYFFKETSHESVDSSKEEPQTLPETQDGDLHLQ
EQGSGIDWCLSPADVEAQTTNDQKGSASLTVVQLS
ILINNIPDESQVEKLNVFLSPPDVINYLALTEATG
RICVSQWEGPRRLGCIFCHGDHLLAVNDLKPQSLE
EVSLFLTRSIQKEKLKLTIGRIPNSETFHAASCMC
PSKCQSAAPSQLDKPRLNRAPKRSPAIKKSQQKGA
RE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -