ABIN501563

DHX37 antibody from antibodies-online
DDX37, Dhr1, KIAA1517, MGC2695, MGC4322
Western blot
Data presented on provider website

Antibody data

Product number
ABIN501563
Provider
antibodies-online
Product name
anti-DEAH (Asp-Glu-Ala-His) Box Polypeptide 37 (DHX37) antibody
Provider product page
antibodies-online - ABIN501563
Antibody type
Polyclonal
Antigen
The immunogen for anti-DHX37 antibody: synthetic peptide directed towards the N terminal of human DHX37
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Xenopus
Host
Rabbit
Antigen sequence
PLTKKEKKVLQKILEQKEKKSQRAEMLQKLSEVQA
SEAEM RLFYTTSKLG
Vial size
50 µg