HPA047607

DHX37 antibody from Atlas Antibodies
DDX37, Dhr1, KIAA1517, MGC2695, MGC4322
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA047607
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047607, RRID:AB_2680101
Product name
Anti-DHX37
Provider product page
Atlas Antibodies - HPA047607
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VGACEYASCTPQFCEANGLRYKAMMEIRRLRGQLT
TAVNAVCPEAELFVDPKMQPPTESQVTYLRQIVTA
GLGDHLARRVQSEEMLEDKWRNAYKTPLLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -