HPA036907

DCLRE1A antibody from Atlas Antibodies
hSNM1, KIAA0086, PSO2, SNM1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA036907
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA036907, RRID:AB_10673626
Product name
Anti-DCLRE1A
Provider product page
Atlas Antibodies - HPA036907
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFS
SLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTI
PFHYKRYTHFLLAQSRAG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -