PAB23083

DCLRE1A antibody from Abnova Corporation
hSNM1, KIAA0086, PSO2, SNM1

Antibody data

Product number
PAB23083
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23083, RRID:AB_11123510
Product name
DCLRE1A polyclonal antibody
Provider product page
Abnova Corporation - PAB23083
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant DCLRE1A.
Antigen sequence
TTPGKLCRTQKSQHVSPKIRPVYDGYCPNCQMPFS
SLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTI
PFHYKRYTHFLLAQSRAG
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -