ABIN501704

DCLRE1A antibody from antibodies-online
hSNM1, KIAA0086, PSO2, SNM1

Antibody data

Product number
ABIN501704
Provider
antibodies-online
Product name
anti-Thyroid Hormone Receptor Associated Protein 3 (THRAP3) antibody
Provider product page
antibodies-online - ABIN501704
Antibody type
Polyclonal
Antigen
The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3
Reactivity
Human, Mouse, Rat, Bovine, Canine, Xenopus
Host
Rabbit
Antigen sequence
GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEI
EDDES GTENREEKDN
Vial size
50 µg
Provider Type Product Number
- No reagents -