HPA003097

NF2 antibody from Sigma-Aldrich
merlin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003097
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003097, RRID:AB_1079473
Product name
Anti-NF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003097
Antibody type
Polyclonal
Antigen
Merlin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ERRAKQKLLEIATKPTYPPMNPIPAPLPPDIPSFN
LIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKH
LQEQLNELKTEIEALKLKERETALDILHNENSDRG
GSSKHNTIKKLTLQSAKSRVA
Storage
-20C
Provider Type Product Number
- No reagents -