Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183972 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Transformer 2 beta Homolog (Drosophila) (TRA2B) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SFRS10 antibody: synthetic peptide directed towards the N terminal of human SFRS10
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
MSDSGEQNYGERESRSASRSGSAHGSGKSARHTPA
RSRSK EDSRRSRSKS- Vial size
- 0.1 mg
Submitted references Tra2β protein is required for tissue-specific splicing of a smooth muscle myosin phosphatase targeting subunit alternative exon.
Evidence for a modifying pathway in SMA discordant families: reduced SMN level decreases the amount of its interacting partners and Htra2-beta1.
Fu K, Mende Y, Bhetwal BP, Baker S, Perrino BA, Wirth B, Fisher SA
The Journal of biological chemistry 2012 May 11;287(20):16575-85
The Journal of biological chemistry 2012 May 11;287(20):16575-85
Evidence for a modifying pathway in SMA discordant families: reduced SMN level decreases the amount of its interacting partners and Htra2-beta1.
Helmken C, Hofmann Y, Schoenen F, Oprea G, Raschke H, Rudnik-Schöneborn S, Zerres K, Wirth B
Human genetics 2003 Dec;114(1):11-21
Human genetics 2003 Dec;114(1):11-21
No comments: Submit comment
No validations: Submit validation data