Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB15689 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#PAB15689, RRID:AB_10680228
- Product name
- Ppfia3 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against partial recombinant Ppfia3.
- Antigen sequence
DKTNHVSKEEAGVPRGEGPAVPGDTPPPTPRSARL
ERMAQALALQAGSPEDGAPPRGSESTPDSLHKAPK
RKSIKSSIGRLFGKKEKGRMGPPGRESVSLAGTPS
DETLATDPLGLAKLTGPGDKDRRNKRKHELLEEAC
RQGLPFAAWDG- Storage
- Store at -20°C.Aliquot to avoid repeated freezing and thawing.
Submitted references A comprehensive approach for establishment of the platform to analyze functions of KIAA proteins II: public release of inaugural version of InGaP database containing gene/protein expression profiles for 127 mouse KIAA genes/proteins.
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
Koga H, Yuasa S, Nagase T, Shimada K, Nagano M, Imai K, Ohara R, Nakajima D, Murakami M, Kawai M, Miki F, Magae J, Inamoto S, Okazaki N, Ohara O
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
DNA research : an international journal for rapid publication of reports on genes and genomes 2004 Aug 31;11(4):293-304
High-throughput production of recombinant antigens for mouse KIAA proteins in Escherichia coli: computational allocation of possible antigenic regions, and construction of expression plasmids of glutathione-S-transferase-fused antigens by an in vitro recombination-assisted method.
Hara Y, Shimada K, Kohga H, Ohara O, Koga H
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
DNA research : an international journal for rapid publication of reports on genes and genomes 2003 Jun 30;10(3):129-36
Liprins, a family of LAR transmembrane protein-tyrosine phosphatase-interacting proteins.
Serra-Pagès C, Medley QG, Tang M, Hart A, Streuli M
The Journal of biological chemistry 1998 Jun 19;273(25):15611-20
The Journal of biological chemistry 1998 Jun 19;273(25):15611-20
No comments: Submit comment
No validations: Submit validation data