ABIN631473
antibody from antibodies-online
Targeting: CDC42EP4
BORG4, CEP4, KAIA1777, MGC17125, MGC3740
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN631473 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-CDC42 Effector Protein (Rho GTPase Binding) 4 (CDC42EP4) antibody
- Antibody type
- Polyclonal
- Antigen
- CDC42 EP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLGSLRDSALFVKNAMSLPQ
- Description
- Affinity purified
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data