HPA023335

CDC42EP4 antibody from Sigma-Aldrich
BORG4, CEP4, KAIA1777, MGC17125, MGC3740
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023335, RRID:AB_10603783
Product name
Anti-CDC42EP4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023335
Antibody type
Polyclonal
Antigen
CDC42 effector protein (Rho GTPase binding) 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RHTMHVGRAGDAFGDTSFLNSKAGEPDGESLDEQP
SSSSSKRSLLSRKFRGSKRSQSVTRGEREQRDMLG
SLRDSALFVKNAMSLPQLNEKEAAEKGTSK
Storage
-20C
Provider Type Product Number
- No reagents -