Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00060675-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00060675-A01, RRID:AB_462814
- Product name
- PROK2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant PROK2.
- Antigen sequence
LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKS
IRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCL
PGLACLRTSFNRFICLAQK- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Abnormalities of neurotransmitter and neuropeptide systems in human neuroepithelioma cells infected by three Toxoplasma strains.
The prokineticin receptor-1 (GPR73) promotes cardiomyocyte survival and angiogenesis.
Xiao J, Li Y, Jones-Brando L, Yolken RH
Journal of neural transmission (Vienna, Austria : 1996) 2013 Dec;120(12):1631-9
Journal of neural transmission (Vienna, Austria : 1996) 2013 Dec;120(12):1631-9
The prokineticin receptor-1 (GPR73) promotes cardiomyocyte survival and angiogenesis.
Urayama K, Guilini C, Messaddeq N, Hu K, Steenman M, Kurose H, Ert G, Nebigil CG
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Sep;21(11):2980-93
FASEB journal : official publication of the Federation of American Societies for Experimental Biology 2007 Sep;21(11):2980-93
No comments: Submit comment
No validations: Submit validation data