H00051440-B01

HPCAL4 antibody from Abnova Corporation
DKFZp761G122, HLP4

Antibody data

Product number
H00051440-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051440-B01, RRID:AB_1204497
Product name
HPCAL4 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00051440-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human HPCAL4 protein.
Antigen sequence
MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFL
KDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAF
EMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAA
KSDPSIVLLLQCDMQK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -