ABIN633361

antibody from antibodies-online

Targeting: DHX9 DDX9, LKP, RHA

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN633361 - Provider product page
Provider: antibodies-online
Product name: anti-DHX9 antibody
Antibody type: Polyclonal
Antigen: DHX9 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGPDHNRSFIAEMTIYIK
Description: Affinity purified
Reactivity: Human, Mouse, Rat, Canine
Host: Rabbit
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles.

DHX9 protein structure - ABIN633361 shown in red.