Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN309821 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-DHX9 antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DHX9 antibody: synthetic peptide directed towards the N terminal of human DHX9
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
GLHGNWTLENAKARLNQYFQKEKIQGEYKYTQVGP
DHNRS FIAEMTIYIK- Vial size
- 50 µg
Submitted references BRCA1 regulates microRNA biogenesis via the DROSHA microprocessor complex.
The nuclear import of RNA helicase A is mediated by importin-alpha3.
Kawai S, Amano A
The Journal of cell biology 2012 Apr 16;197(2):201-8
The Journal of cell biology 2012 Apr 16;197(2):201-8
The nuclear import of RNA helicase A is mediated by importin-alpha3.
Aratani S, Oishi T, Fujita H, Nakazawa M, Fujii R, Imamoto N, Yoneda Y, Fukamizu A, Nakajima T
Biochemical and biophysical research communications 2006 Feb 3;340(1):125-33
Biochemical and biophysical research communications 2006 Feb 3;340(1):125-33
No comments: Submit comment
No validations: Submit validation data