HPA028050

DHX9 antibody from Sigma-Aldrich
DDX9, LKP, RHA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028050
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA028050, RRID:AB_10603564
Product name
Anti-DHX9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA028050
Antibody type
Polyclonal
Antigen
DEAH (Asp-Glu-Ala-His) box polypeptide 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PHLALKAENNSEVGASGYGVPGPTWDRGANLKDYY
SRKEEQEVQATLESEEVDLNAGLHGNWTLENAKAR
LNQYFQKEKIQGEYKYTQVGPDHNRSF
Storage
-20C
Provider Type Product Number
- No reagents -