Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA018798 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA018798, RRID:AB_2669928
- Product name
- Anti-PIWIL1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELR
DWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQ
FADWSKETRGAPLISVKPL- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PIWIL1 is recruited to centrosomes during mitosis in colorectal cancer cells and is linked to cell cycle progression
Expression Levels of 4 Genes in Colon Tissue Might Be Used to Predict Which Patients Will Enter Endoscopic Remission After Vedolizumab Therapy for Inflammatory Bowel Diseases
Garcia-Silva M, Montenegro S, Dacosta S, Tosar J, Cayota A
Scientific Reports 2024;14(1)
Scientific Reports 2024;14(1)
Expression Levels of 4 Genes in Colon Tissue Might Be Used to Predict Which Patients Will Enter Endoscopic Remission After Vedolizumab Therapy for Inflammatory Bowel Diseases
Verstockt B, Verstockt S, Veny M, Dehairs J, Arnauts K, Van Assche G, De Hertogh G, Vermeire S, Salas A, Ferrante M
Clinical Gastroenterology and Hepatology 2020;18(5):1142-1151.e10
Clinical Gastroenterology and Hepatology 2020;18(5):1142-1151.e10
No comments: Submit comment
No validations: Submit validation data