H00023024-B01

PDZRN3 antibody from Abnova Corporation
KIAA1095, LNX3, SEMACAP3, SEMCAP3

Antibody data

Product number
H00023024-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023024-B01, RRID:AB_1204779
Product name
PDZRN3 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023024-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PDZRN3 protein.
Antigen sequence
MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGH
VFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLP
LKRLILKLDIKCAYATRGCGRVVKLQQLPEHLERC
DFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVG
RCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQA
RLGALHKALKKEALRAGKREKSLVAQLAAAQLELQ
MTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEET
KSLTLVLHRDSGSLGFNIIGGRPSVDNHDGSSSEG
IFVSKIVDSGPAAKEGGLQIHDRIIEVNGRDLSRA
THDQAVEAFKTAKEPIVVQVLRRTPRTKMFTPPSE
SQLVDTGTQTDITFEHIMALTKMSSPSPPVLDPYL
LPEEHPSAHEYYDPNDYIGDIHQEMDREELELEEV
DLYRMNSQDKLGLTVCYRTDDEDDIGIYISEIDPN
SIAAKDGRIREGDRIIQINGIEVQNREEAVALLTS
EENKNFSLLIARPELQLDEGWMDDDRNDFLDDLHM
DMLEEQHHQAMQFTASVLQQKKHDEDGGTTDTATI
LSNQHEKDSGVGRTDESTRNDESSEQENNGDDATA
SSNPLAGQRKLTCSQDTLGSGDLPFSNESFISADC
TDADYLGIPVDECERFRELLELKCQVKSATPYGLY
YPSGPLDAGKSDPESVDKELELLNEELRSIELECL
SIVRAHKMQQLKEQYRESWMLHNSGFRNYNTSIDV
RRHELSDITELPEKSDKDSSSAYNTGESCRSTPLT
LEISPDNSLRRAAEGISCPSSEGAVGTTEAYGPAS
KNLLSITEDPEVGTPTYSPSLKELDPNQPLESKER
RASDGSRSPTPSQKLGSAYLPSYHHSPYKHAHIPA
HAQHYQSYMQLIQQKSAVEYAQSQMSLVSMCKDLS
SPTPSEPRMEWKVKIRSDGTRYITKRPVRDRLLRE
RALKIREERSGMTTDDDAVSEMKMGRYWSKEERKQ
HLVKAKEQRRRREFMMQSRLDCLKEQQAADDRKEM
NILELSHKKMMKKRNKKIFDNWMTIQELLTHGTKS
PDGTRVYNSFLSVTTV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -