Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502105 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Pulmonary Surfactant-Associated Protein B (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SFTPB antibody: synthetic peptide directed towards the middle region of human SFTPB
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIK
RIQAM IPKGALAVAV- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Population and disease-based prevalence of the common mutations associated with surfactant deficiency.
Garmany TH, Wambach JA, Heins HB, Watkins-Torry JM, Wegner DJ, Bennet K, An P, Land G, Saugstad OD, Henderson H, Nogee LM, Cole FS, Hamvas A
Pediatric research 2008 Jun;63(6):645-9
Pediatric research 2008 Jun;63(6):645-9
No comments: Submit comment
No validations: Submit validation data