HPA030558

UFL1 antibody from MilliporeSigma / Merck KGaA
KIAA0776, Maxer, NLBP, RCAD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA030558
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA030558, RRID:AB_10600663
Product name
Anti-KIAA0776 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA030558
Antibody type
Polyclonal
Antigen
KIAA0776 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLFSAITRPTAVNSLISKYGFQEQLLYSVLEELVN
SGRLRGTVVGGRQDKAVFVPDIYSRTQSTWVDSFF
RQNGYLEFDALSRLGIPDAVS
Storage
-20C
Provider Type Product Number
- No reagents -