Antibody data

Product number
H00028968-M13
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028968-M13, RRID:AB_1580729
Product name
SLC6A16 monoclonal antibody (M13), clone 2E5
Provider product page
Abnova Corporation - H00028968-M13
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC6A16.
Antigen sequence
RCCERNAEILLKLINLGKLPPDAKPPVNLLYNPTS
IYNAWLSGLPQHIKSMVLREVTECNIETQFLKASE
GPKFAFLSFVEAMSFLP
Isotype
IgG
Antibody clone number
2E5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -