Antibody data

Product number
H00006608-M14
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006608-M14, RRID:AB_1137040
Product name
SMO monoclonal antibody (M14), clone 3D10
Provider product page
Abnova Corporation - H00006608-M14
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SMO.
Antigen sequence
NLWLVEAEISPELQKRLGRKKKRRKRKKEVCPLAP
PPELHPPAPAPSTIPRLPQLPRQKCLVAAGAWGAG
DSCRQGAWTLVSNPFCPEPSPPQDPFLPSAPAPVA
WAHGRRQGLGPIHSRTNLMDTELMDADSDF
Isotype
IgG
Antibody clone number
3D10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -