HPA027756

CD300LD antibody from Sigma-Aldrich
CD300D, CMRF35A4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027756
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027756, RRID:AB_10601097
Product name
Anti-CD300LD antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027756
Antibody type
Polyclonal
Antigen
CD300 molecule-like family member d recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSE
WTTTTASLAFTAAATQKTSSPLTRSPLKSTH
Storage
-20C
Provider Type Product Number
- No reagents -