Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405593 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 7 (SLC10A7) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC10A7 antibody: synthetic peptide directed towards the middle region of human SLC10A7
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
TTFCDTFSNPNIDLDKFSLVLILFIIFSIQLSFML
LTFIF STRNNSGFTP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular and phylogenetic characterization of a novel putative membrane transporter (SLC10A7), conserved in vertebrates and bacteria.
Godoy JR, Fernandes C, Döring B, Beuerlein K, Petzinger E, Geyer J
European journal of cell biology 2007 Aug;86(8):445-60
European journal of cell biology 2007 Aug;86(8):445-60
No comments: Submit comment
No validations: Submit validation data