HPA000662

SLC25A21 antibody from Sigma-Aldrich
ODC, ODC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000662
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000662, RRID:AB_1080000
Product name
Anti-SLC25A21 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000662
Antibody type
Polyclonal
Antigen
Mitochondrial 2-oxodicarboxylate carrier recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKT
RFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYK
GILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPA
LTFAIAGLGSGLTEAIVVNPFEVVKVGL
Storage
-20C
Provider Type Product Number
- No reagents -