HPA003098

EFCAB6 antibody from Atlas Antibodies
dJ185D5.1, DJBP, FLJ23588, HSCBCIP1, KIAA1672
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003098
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003098, RRID:AB_888340
Product name
Anti-EFCAB6
Provider product page
Atlas Antibodies - HPA003098
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNY
ISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHD
NAINYLDFLRAVENSKSTGAQPKEKEESMPINFAT
LNPQEVVRKIQEVVESSQLALSTAFSALDKEDT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -