HPA003098

EFCAB6 antibody from Atlas Antibodies
dJ185D5.1, DJBP, FLJ23588, HSCBCIP1, KIAA1672

Antibody data

Product number
HPA003098
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003098, RRID:AB_1079087
Product name
Anti-EFCAB6
Provider product page
Atlas Antibodies - HPA003098
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QQSTEKAVAARDKLMDRHQDISKAFTKTDQSKTNY
ISICKMQEVLEECGCSLTEGELTHLLNSWGVSRHD
NAINYLDFLRAVENSKSTGAQPKEKEESMPINFAT
LNPQEVVRKIQEVVESSQLALSTAFSALDKEDT
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.