HPA018946

EFCAB6 antibody from Sigma-Aldrich
dJ185D5.1, DJBP, FLJ23588, HSCBCIP1, KIAA1672
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018946
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018946, RRID:AB_1851117
Product name
Anti-EFCAB6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018946
Antibody type
Polyclonal
Antigen
EF-hand calcium-binding domain-containing protein 6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKTTLTKKMTTEEVIEKFKKCIQQQDPAFKKRFLD
FSKEPNGKINVHDFKKVLEDTGMPMDDDQYALLTT
KIGFEKEGMSYLDFAAGFEDPPMRGPETTPPQPPT
PSKSYVNSHFITAEECLKLFPRRLKESFRDPY
Storage
-20C
Provider Type Product Number
- No reagents -