Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002632-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002632-A01, RRID:AB_463279
- Product name
- GBE1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GBE1.
- Antigen sequence
SEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVG
TALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAF
EHNGRPYSLLVYIPSRVALILQNVDLPN- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Muscle glycogen remodeling and glycogen phosphate metabolism following exhaustive exercise of wild type and laforin knockout mice.
Polyglucosan neurotoxicity caused by glycogen branching enzyme deficiency can be reversed by inhibition of glycogen synthase.
Irimia JM, Tagliabracci VS, Meyer CM, Segvich DM, DePaoli-Roach AA, Roach PJ
The Journal of biological chemistry 2015 Sep 11;290(37):22686-98
The Journal of biological chemistry 2015 Sep 11;290(37):22686-98
Polyglucosan neurotoxicity caused by glycogen branching enzyme deficiency can be reversed by inhibition of glycogen synthase.
Kakhlon O, Glickstein H, Feinstein N, Liu Y, Baba O, Terashima T, Akman HO, Dimauro S, Lossos A
Journal of neurochemistry 2013 Oct;127(1):101-13
Journal of neurochemistry 2013 Oct;127(1):101-13
No comments: Submit comment
No validations: Submit validation data