HPA028946

VAX1 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028946
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028946, RRID:AB_10602679
Product name
Anti-VAX1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028946
Antibody type
Polyclonal
Antigen
ventral anterior homeobox 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MDVRCHSDAEAARVSKNAHKESRESKGAEGNLPAA
FLKEPQGAFSASGAAEDCNKSKSNSAADPDYCRRI
LVRDAKGSIREIILPKGLDLD
Storage
-20C
Provider Type Product Number
- No reagents -