HPA031608

ASCC3 antibody from Atlas Antibodies
ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH

Antibody data

Product number
HPA031608
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA031608, RRID:AB_10599970
Product name
Anti-ASCC3
Provider product page
Atlas Antibodies - HPA031608
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFG
PFPSSSATAACNATNRIISHFSQDDLTALVQMTEK
EHGDRVFFGKNLAFSFDMHDLDHFDELPING
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.