HPA031608

ASCC3 antibody from MilliporeSigma / Merck KGaA
ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031608
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ASCC3 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031608
Antibody type
Polyclonal
Antigen
activating signal cointegrator 1 complex subunit 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GREAIESGAAFLFMTFHLKDSVGHKETKAIKQMFG
PFPSSSATAACNATNRIISHFSQDDLTALVQMTEK
EHGDRVFFGKNLAFSFDMHDLDHFDELPING
Storage
-20C