HPA011959

PRR12 antibody from Sigma-Aldrich
KIAA1205
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011959
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011959, RRID:AB_10610286
Product name
Anti-PRR12 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011959
Antibody type
Polyclonal
Antigen
proline rich 12 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKVKAEPPPKKRKKWLKEAGGNATAGGGPPGSSSD
SESSPGAPSEDERAVPGRLLKTRAMREMYRSYVEM
LVSTALDPD
Storage
-20C
Provider Type Product Number
- No reagents -